SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374327564|ref|YP_005085764.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327564|ref|YP_005085764.1|
Domain Number 1 Region: 97-166
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000247
Family Transcription factor IIB (TFIIB), core domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|374327564|ref|YP_005085764.1|
Domain Number - Region: 34-96
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0015
Family Tetracyclin repressor-like, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374327564|ref|YP_005085764.1|
Sequence length 172
Comment hypothetical protein P186_2120 [Pyrobaculum sp. 1860]
Sequence
MFFGRQYSEEELRLIRCIEEVVAGSGGGSDDRCLRAAAEYLCRKRLGEAASLDKIAARHG
VQLLCVYRWYSKLFQMGYRYPRDEFEHHLETVRKIYGEAVAEEVRRLYEFLKSKGAVQGL
KPGGVVAALLYYAAKKHRFKYDVVKAAYEFDTYPETVEKNIVLFQWYIHGII
Download sequence
Identical sequences G7VAT4
gi|374327564|ref|YP_005085764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]