SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374328321|ref|YP_005086521.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374328321|ref|YP_005086521.1|
Domain Number 1 Region: 30-135,563-597,673-711
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000434
Family YhhF-like 0.027
Further Details:      
 
Weak hits

Sequence:  gi|374328321|ref|YP_005086521.1|
Domain Number - Region: 566-667
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000466
Family YhhF-like 0.091
Further Details:      
 
Domain Number - Region: 93-246
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000736
Family YhhF-like 0.026
Further Details:      
 
Domain Number - Region: 758-831
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 0.0939
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374328321|ref|YP_005086521.1|
Sequence length 994
Comment putative DNA methylase [Pyrobaculum sp. 1860]
Sequence
MTSLLESGIPIEAINEYSEVEKGPGRPPHWEMVFWWTRKPLAGARAVIAAALLPADAYSN
PEQFLNDLFPCRRERKTVYQCNPSPRLVERLRGKKVLDPFAGFGSIPLEAARLGADAAAV
ELLPTAYVFLKAVLEYPKKFSHLTTEITGREAKELGLEDVVKKFNGVKAVADSARYKVPA
LIYDVAKWGRWVLEQLRNDSDVAGLYDADVYIGTWEVKCPVCGRYTPLVGNWWLARVKGK
TYYERLAWMKWEDGRISVVDLNEECRRQGGGSCGELNAKVQTREEEGGGSVEWRGQRYAV
PAKNIDARRETAQCLHCRAEINHRVVNGKITKGGRRDGDWYVKWALRQWNELYEKYLRGE
VTLEELKNASVRPTLLAKVYVKDGDLQFQPATQQDMDKLWQAAERLRRMWGDPDIPTEEL
WKYHMGTAGQLSIWTWGFNKFFKLFNPRQLLTLVKLVKLIREAGKKIEEDKLKEGLNKEE
ALKYAEAVTTYLAIALTNMSDFNSISSQWQATAWQPVKRAFAMRGISMQWNYGDVKPYSK
GTGSWNNAIENIISSLSYLVFATSGSPSRFWVVLDDASELSKLEGGKFDVIITDPPYADD
VAYSELSDFYFVWLKRALSDSDGAALRPRFVPEAFFDELGLEVRTQWERFAVREVSESVG
RWEYFKISATFRDMLAKAFANVLRFLKEDGLLVTYYVAKKPESWAALVDALWRVNGLEMV
AAYPVATESEENVVARGKASVLGGYVSAWRRRSGPKPLDLSAERDRVVEEVAERVDRRLR
AVSSGAKKKNGTTAWVYAYLAALEYLTAHSPVTLGGLELDSEGLMRQAVAIAFEALLRKA
GVRLSDPAAHAYLALRIMENERGYVDSDTLSHVERATGLPHVDLIKLGLIREADVGGPRV
AKRKAFEVLAPRGDTVDEIRRVYSAQRGRPVLDCFRQLQLNLLAKTSVTCAPEVREEALA
LARALVELARAGVLDEDDVDVKTAKVILGAEWWG
Download sequence
Identical sequences G7VFR3
gi|374328321|ref|YP_005086521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]