SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317153918|ref|YP_004121966.1| from Desulfovibrio aespoeensis Aspo-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317153918|ref|YP_004121966.1|
Domain Number 1 Region: 71-154
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000155
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|317153918|ref|YP_004121966.1|
Domain Number - Region: 259-318
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.034
Family DmpA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317153918|ref|YP_004121966.1|
Sequence length 431
Comment hypothetical protein Daes_2214 [Desulfovibrio aespoeensis Aspo-2]
Sequence
MFFFLFVNRMRARPGNFSPAALFISQELRYLCHSHEPGGPPTTGPRDTIVPQHPLPPGHP
GASVLAVTGAGQLRFEIRGRLDAPGTAHVWDEASRVASAGSGGAVEADCSGIEYMDGSGM
ALLLKLREVVAEAGGTLSLVNLAPRHRQLIDLTGDRPLPGWNPADSERRGLAERVGRATR
DALTGIREMVEFVGEASVIITRSLLHPSRVRWKDVLLSCVHVGVDSLFIISLLGFLMGLI
MSFQSAISLQRFGGEIFVPNMLGLVMFREMGPLVTAILLAARSGSAFAAEIGTMKINEEL
DALTTMGLSPMRFLVVPKLLSALAMVPLMTLFFNLASLVGGALVMLSLGFPLVTFTSRVF
SYVHYSDFFGGMAKALVFSILVAGVGCLRGMQTRSGASAVGLSTTSAVVTGIIFIAFADG
LFAVAFYYLKI
Download sequence
Identical sequences E6VSX6
gi|317153918|ref|YP_004121966.1| WP_013515132.1.85979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]