SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330506389|ref|YP_004382817.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330506389|ref|YP_004382817.1|
Domain Number 1 Region: 669-927
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.43e-94
Family BC ATP-binding domain-like 0.000000838
Further Details:      
 
Domain Number 2 Region: 128-398
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-94
Family BC ATP-binding domain-like 0.000000474
Further Details:      
 
Domain Number 3 Region: 553-671
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.4e-51
Family BC N-terminal domain-like 0.00000188
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-46
Family BC N-terminal domain-like 0.00000336
Further Details:      
 
Domain Number 5 Region: 932-1068
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.22e-34
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00069
Further Details:      
 
Domain Number 6 Region: 393-547
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 6.67e-32
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330506389|ref|YP_004382817.1|
Sequence length 1070
Comment carbamoyl-phosphate synthase, large subunit [Methanosaeta concilii GP6]
Sequence
MPKREDINKIMIIGSGPIVIGQACEFDYSGTQACKALKALGYKIVLVNSNPATIMTDPGM
ADATYIEPLNVERLAQIIEKERPDALLPNLGGQNGLNLSLELARAGILDKFNVMVIGVKL
DAIERGEDRIIFKETMNSLGIEVPKSTAIYTVEDAEKVALDLGYPVVVRPAYTMGGTGGG
LVYNAEELRTVVSRGIAASLIGQVLIEESVAGWEELELEVVRDSKNHMITVCFIENVDAM
GVHTGDSFCTAPMLTISQELQDKLQDYSYRIVEAIKVIGGTNIQFAHDPKTGRVVVIEIN
PRTSRSSALASKATGFPIALISAKLASGLTMDEIPYWKEGTLEKYTPSGDYVVVKFPRWA
FEKFRGSKDVLGTQMKAVGEAMSIGKSYKEAFQKAIRSLENSRYGLGFARDYNSRSPEEL
MMLLKETSSERQFILYEAIRKGADIQKLYQLTHIKPWFLQQMKELVQLEEEILAYKGKPL
VDLPDELLSQAKKDGFADRYLSKLLAVPEAEIRARRKSLGIVQGWEPVPVSGVENAFYYY
STYNAPDRTPSSSRRKVMVLGGGPNRIGQGIEFDYCCVHAAFALRDMGIETIMVNCNPET
VSTDYDTSDKLYFEPLTVEDVLSIYEKEKPEGVIVQFGGQTPLNISRELEDAGVKILGTS
VDAIDLAEDRDRFRMMMEELDIPMPESGMASNLDQALEVAKRIGYPLMVRPSYVLGGRGM
EVIYDEEMLERYVAAAVDVTPERPILIDRFLENALETEADALSDGKEAFVPAVMEHIEQA
GIHSGDSACVIPPVSISGEHLQTIEEYTRKIAQKLHVVGLMNMQYAISHDVVYVLEANPR
ASRTVPLVSKVCNVSMARIATQMMMNKRMDELGLKKRNIPHYGVKESVFPFNMFPEVDPL
LGPEMRSTGEVLGLADSFGMAFYKAEEAAKPSLPQEGTVMITVAAKDRSMELVEVAREFQ
KLGFRIMATSGTRAVLKENGIPSEMIKKIYEGRPNIDDAIKNKEIQLVINTPIGKASQYD
DSYIRKAAIKYKVPYITTIAAASAAAKGISASRAGHSAAKSLQEYHSDIK
Download sequence
Identical sequences F4BTW6
gi|330506389|ref|YP_004382817.1| WP_013718061.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]