SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330506455|ref|YP_004382883.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330506455|ref|YP_004382883.1|
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily Ferritin-like 7.19e-42
Family Ferritin 0.0000122
Further Details:      
 
Domain Number 2 Region: 148-190
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000362
Family Rubredoxin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330506455|ref|YP_004382883.1|
Sequence length 191
Comment rubrerythrin [Methanosaeta concilii GP6]
Sequence
MKSLKGTQTEKNLLLSFAGESQARNRYSYFGSQAKKEGYEQIAAIFLDTADNEKEHAKVF
FKLLEGGELEINGSFPAGVIGDTKANLMEAAEGEKFENTKMYPQFAATADKEGFPEIAEK
FRNVCKVEKGHEDRYRALLKNVEEGKVFKKDTKVAWRCRNCGYIHEGTEAPDECPACAHE
QAYFELMAKNY
Download sequence
Identical sequences F4BUJ0
gi|330506455|ref|YP_004382883.1| WP_013718127.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]