SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330507176|ref|YP_004383604.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330507176|ref|YP_004383604.1|
Domain Number 1 Region: 166-357
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.83e-62
Family Actin/HSP70 0.00000174
Further Details:      
 
Domain Number 2 Region: 359-515
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 2.75e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000023
Further Details:      
 
Domain Number 3 Region: 1-163
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.45e-51
Family Actin/HSP70 0.00000928
Further Details:      
 
Domain Number 4 Region: 482-581
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000746
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330507176|ref|YP_004383604.1|
Sequence length 622
Comment chaperone protein DnaK [Methanosaeta concilii GP6]
Sequence
MSKIIGIDLGTSNSAAAVLIGGRPTIIPSAEGTSIGGKAFPSYVAFTKDGQVLVGEPAKR
QAVTNPDGTVQGIKRKMGTDYKVRVFDKEYTPEDISAQVLRKIKTDAETYLADSVDKAVI
TVPAYFNDNQRQATKDAGTIAGLEVVRIINEPTAAALAFGLDKVGEHKIMVFDLGGGTLD
VTIMEIGEGVFEVLSTSGDTQLGGRDMDDRLTNYVLDRFKQESGVDLRGDSMAMQRLREA
VEVAKIELSSVLQTNLNLPYITADASGPKHLSMTIARSKLEELVADVLERCRGPMIQALK
DSKLEKSDIGKIILVGGPTRMPMVQEFVKNFLGKDIERGVDPMECVAMGAAIQAGVLGGE
VKDLLLLDVTPLSLGIETLGSVTTKLIERNTTIPTRKSQIFTTAADNQTSVEVNVLQGER
PMAQDNVSLGRFTLVGIPPAPRGIPQIEVTFDIDANGIIHVSAKDLATKKEQRITITAPH
KLSQEDIDAKIKDAERFAADDLKRKEEIEVKNAAESLIYASEKMLKEAGDIATSEQKEKI
EKAISDLKNAQTGGEISEIKAKTESLQNAIYELSAAMYQKAAQDQQAQQGQAGQGSGPEA
GQDSTGQDQTVDADYEVVNDKK
Download sequence
Identical sequences F4BZ87
gi|330507176|ref|YP_004383604.1| WP_013718835.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]