SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330507269|ref|YP_004383697.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330507269|ref|YP_004383697.1|
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily YrdC/RibB 1.6e-85
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00000107
Further Details:      
 
Domain Number 2 Region: 205-375
Classification Level Classification E-value
Superfamily RibA-like 3.14e-68
Family RibA-like 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330507269|ref|YP_004383697.1|
Sequence length 402
Comment 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II [Methanosaeta concilii GP6]
Sequence
MPFCTVEEAISDIRAGRFIIILDDENRENEGDLMMAAENVTPEAINFMARFGRGLICMPM
TAERLRELDIPLMTSQNTESMGTAFTVSVDARINTTTGISAFDRATTVHALIDPVTRRND
IVTPGHLFPLQAKEGGVLRRTGHTEACVDLARLAGLQPAGVIVEIMNDDGTMARLPQLER
FAQEHGLKMLTIESLIRYRMQYEKLVCRISEVSMPTEYGLFTAIGYESVLDGQCHIALVA
GDPTCPDALVRVHSECLTGDVFSSKRCDCGEQLRRALQLISKNGNGVLLYMRQEGRGIGL
ANKLRAYALQDGGSDTVEANHRLGYPADLRDYGIGAQILVDLGIKQIRLLTNNPRKVIGL
EGYGLEIAERVPLEVEPNNINRRYLETKRDKMHHLLLQNEGQ
Download sequence
Identical sequences F4BZQ9
gi|330507269|ref|YP_004383697.1| WP_013718928.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]