SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330507878|ref|YP_004384306.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330507878|ref|YP_004384306.1|
Domain Number 1 Region: 49-136
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.0000000000116
Family Thiamin pyrophosphokinase, catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330507878|ref|YP_004384306.1|
Sequence length 210
Comment hypothetical protein MCON_1908 [Methanosaeta concilii GP6]
Sequence
MQFATWEPFYNQILQDFGFSSARDEEGAHLLAELLQYSGDCRPSAEERIRGRKAVIFGNA
PSLDRELDALPPMDAARIAADGAAAVLLRRGIVPDVVVSDLDGPFPAILEACQKKAIIVV
HAHGDNLDALARYVPQLENVIGTCQCRPSGGLYNFGGFTDGDRSVFLAVELGASSIELVG
FDFEDQSVTPRKRKKLAWAKRLIEIALSEK
Download sequence
Identical sequences A0A0W8F5Z7 F4BW58
WP_013719530.1.75657 gi|330507878|ref|YP_004384306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]