SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330508290|ref|YP_004384718.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508290|ref|YP_004384718.1|
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Transposase IS200-like 2.62e-36
Family Transposase IS200-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330508290|ref|YP_004384718.1|
Sequence length 154
Comment transposase, IS200 family [Methanosaeta concilii GP6]
Sequence
MELRSFSHGYGQITYHIVLVPKYRYKIFYDKRVKKDCELVLSKICMEQGYKIHAMEIVDD
HVHLFLEFRLSYSLSRVVQFLKGGISYRMFKLHPELKKRYWGGSLWSSGKFFRSVGNVTA
DTIQHYIKESQGKPKAESKVCRSRESGQRRLDDF
Download sequence
Identical sequences F4BYM8
WP_013719929.1.75657 gi|330508290|ref|YP_004384718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]