SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330508352|ref|YP_004384780.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|330508352|ref|YP_004384780.1|
Domain Number - Region: 51-93
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000641
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 
Domain Number - Region: 41-164
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0722
Family FCH domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330508352|ref|YP_004384780.1|
Sequence length 166
Comment hypothetical protein MCON_2534 [Methanosaeta concilii GP6]
Sequence
MKFWQEMQKLNLKILIGIIAVIIIIDILQYASYQGDYNKMDQLSSEISQDKQAIASLNET
ISLEEKEIDQRKAERDSIKAQLDAWEMRMDKMTPSEYNQNVDPYNALVSQYNSLRDPYNE
LVNKYNADIEKYNLQRDIINIKIDEYNELAKKPRQYLIPMPIPHHR
Download sequence
Identical sequences F4BZ15
gi|330508352|ref|YP_004384780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]