SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330509011|ref|YP_004385439.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330509011|ref|YP_004385439.1|
Domain Number 1 Region: 98-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.52e-58
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000958
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.29e-41
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 316-444
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 6.02e-29
Family SerA intervening domain-like 0.0029
Further Details:      
 
Domain Number 4 Region: 451-523
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000383
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330509011|ref|YP_004385439.1|
Sequence length 525
Comment phosphoglycerate dehydrogenase [Methanosaeta concilii GP6]
Sequence
MKVLVSDSLAEDGVKRLQSGADVDVITNLSPEELIQKIPDYDALVIRSGTKVTADVINAA
KRLKVIGRAGVGIDNVDVEAATKKGIIVLNTPGGNTISAAEHTIAMMLALARNIPQANSA
LHQGEWNRKKYTGVEFFNKTLGVVGLGRVGAEVATRMKSFGMRILAYDPFVTEEKAQQMG
LTLANLETVLREGDFITVHTPLTNETRNLIDDDEFKIMKDGVRIVNCARGGIINEAALAK
AVAEGKVAGAAVDVFTKEPPTGNPLLGQERIITTPHLGASTAEAQVNVALAVADQILAIA
KGGLPTNAINMPAISPETLAVMEPYMMLAERMGSLLGQMVGSGFESLELIYSGTIAEKDT
RPVTISAIRGLLGCLMGKDSINFVNATTTLKEMGVKLLESKTESINGYSNAITMKLTKNG
VINMVQGTVSGNKEKRIVQLDLYRTYIPTEGDMVIAVIDDKPNIIGPCCVVLGEGNINIG
SMHVGRMDEGQPQLMVLSVDQMVPDDLMKRLLQVPGVKSAKMVEL
Download sequence
Identical sequences F4BVK8
WP_013720633.1.75657 gi|330509011|ref|YP_004385439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]