SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330509096|ref|YP_004385524.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330509096|ref|YP_004385524.1|
Domain Number 1 Region: 19-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000178
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330509096|ref|YP_004385524.1|
Sequence length 366
Comment hypothetical protein MCON_3483 [Methanosaeta concilii GP6]
Sequence
MARIDDLEQVNFELEDFRARSQETLKTLDQLADFILEFSKLEKDFESKLRGASESLDKLD
QYIIEVESRWSILEPEARKILEQLKDTGNDIHNSFNELKQETDQRGTKLQEDTDKAKVEL
HAALDNLESKLDQSLKYFQDKSEDRYTEINQNLDNHRSRLDEFEKETDQRWMKLQEDTDK
AKVELHAALNNLESKLDQSLKYFQDKSEDRYTEINQNLDNHRSRLDELEKEIDQRGMKLQ
EDITNAQSDFQIANRNLRNELVRMINDLRSESEIRFLEFNNSFDQQKDEFSEVTTGLKDS
IQKMHDELTGDLEVSRQEYKEFFRNAIEKNTTIESQIHELRKQVRAQLAFVGLIVIVILL
YIFKII
Download sequence
Identical sequences F4BW96
gi|330509096|ref|YP_004385524.1| WP_013720711.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]