SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379004825|ref|YP_005260497.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|379004825|ref|YP_005260497.1|
Domain Number - Region: 12-60
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0107
Family ABC transporter transmembrane region 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379004825|ref|YP_005260497.1|
Sequence length 83
Comment hypothetical protein Pogu_1863, partial [Pyrobaculum oguniense TE7]
Sequence
MIYCICKKITESRKIEKLESKFWLRNYILQTVIAVLAIYLGGEYMVHGIIELGTVFNIDQ
TALTVILVPIATVIPESIVGLIF
Download sequence
Identical sequences H6QAW7
gi|379004825|ref|YP_005260497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]