SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379005059|ref|YP_005260731.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379005059|ref|YP_005260731.1|
Domain Number 1 Region: 38-170
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.61e-27
Family Nuclease 0.0022
Further Details:      
 
Domain Number 2 Region: 239-291
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000471
Family Nuclease 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379005059|ref|YP_005260731.1|
Sequence length 353
Comment hypothetical protein Pogu_2097 [Pyrobaculum oguniense TE7]
Sequence
MRLLPLLLALAVAGLLLAASPIRLEVDAVLVSPINTTKIVDYVKAAKKAVYAEVYVFTYK
PLADALVDAARRGVDVYVVLSARVYGGVPQQAKELAAYLQDNGVKVKWNKDFPNVHTKLY
VIDNETVIIGNINPTASGFTRNKGVMLVIRNATLARQLATIVLNDYRGVYPRYNYPGVLV
SPINSQVGLEWILSQPGDLYVAMEQIYMDSGFVPLILQRQRYYAMVARTDADINAAVDDN
LVAKIIVVGDYVYVGSINLGYYSIQRNREVGLLIYNPNLAQRLRGLILQWYTEAGGQPPA
TVTTAPETAAPMTTDGAAPAATPATDYKIHIVVWLVIIIAALLFVIWMNRKKP
Download sequence
Identical sequences H6QCS8
gi|379005059|ref|YP_005260731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]