SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379005722|ref|YP_005261394.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379005722|ref|YP_005261394.1|
Domain Number 1 Region: 205-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.66e-68
Family Leukotriene A4 hydrolase catalytic domain 0.00062
Further Details:      
 
Domain Number 2 Region: 18-196
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.97e-33
Family Leukotriene A4 hydrolase N-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 537-792
Classification Level Classification E-value
Superfamily ARM repeat 4.94e-21
Family PBS lyase HEAT-like repeat 0.033
Further Details:      
 
Weak hits

Sequence:  gi|379005722|ref|YP_005261394.1|
Domain Number - Region: 792-822
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0327
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379005722|ref|YP_005261394.1|
Sequence length 823
Comment Aminopeptidase N [Pyrobaculum oguniense TE7]
Sequence
MKYVVGRDFAFPEYLPRYPREYGFDVLYMWLDISIDVRSGVVEGAVRYRVRAKKDGVPVV
LDAVEMEVRGASHDYYYDGEKIEIRPSWKKGDEIEVQISYRAKPRAGMYFIKPDKTRRGV
YVWTQGETEYNRYWVPLPDSPNIKFPWRVAVTVPKPYVAGSNGVLVEVREGGDRNTYVWE
MRHPMSPYLLAIAIGEYEVHKEDCGGVVLEYYIPKYIDDRWRFSFYNTCKIMKFFSEYLG
VPYPYERYAQVVVPEFIYGGMENTTFTILTDWTIHDKHAHCPYTGFPCPEHEDFSSDPLV
AHEMAHMWFGDLVTAKDWAHIAINESFATFIEALWTEASKGWDEYLYEIYTNFKTYLGEY
TRRYSRPIVTNLYKIPDEVFDRHAYEKGSVVLHMLRSLLGEESFRKGLKLFLERHRYKAV
DMEDLRKAFEEASGRDLEWFWKQFWYSAGHPVVKVSWSYSDGALKLQLRQAQGEDSYPVY
TLPLEVKIVYEDGRKEVREILLNEKEVTLYVQGGKPRYICVDPHFKLMKSLDLGYPLESA
VAMLEDEDMYCRLQAVEVLKKNGSPKAVDALAKALGDKFWGVAAEAARALGEIGTGAAVA
KLVESYRVVSHPIVRRAIVEALGSAKRKEAAEFLDRVLHDAGESYYVRSEAARSLGRVKW
EFAEYSLKKALEYPSHVDVIKRGALEGLAELGTDDALKIVLRHAEPDMPTPVRATAVQSL
AKFGPRKEVVDAVRMYMRDENFRVRFAAVTAALELLEPRLLPDLQERAEQDIDGRVRRVA
REVAEKIKKFMERGTEYQKLREEVEKLREEYRKLADRVARLER
Download sequence
Identical sequences H6QBZ5
gi|379005722|ref|YP_005261394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]