SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379005790|ref|YP_005261461.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379005790|ref|YP_005261461.1|
Domain Number 1 Region: 131-395
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000000000168
Family Lambda integrase-like, catalytic core 0.026
Further Details:      
 
Domain Number 2 Region: 36-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000609
Family Tetracyclin repressor-like, N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379005790|ref|YP_005261461.1|
Sequence length 445
Comment phage integrase family protein [Pyrobaculum oguniense TE7]
Sequence
MPRKSTVDKILAELKEKIKEKRRQEQKRGRPEAVPRDPEVYERIASLFEEGLTVAEVARA
LGVSERTLYRLKESPEFQQFLKEREEKIKKAKEARYKTDAVYNKELLEKIVSGEAWTREA
CEQLSHWEPIQNVCKQWITHNRSRQSLKSAIEEMADIYEYMCRVKQKCDPDLWEPSDFLE
FANSLIQRGVSTDTVRKYLTRWWAWKPEHRETELKGLHGKWVRRGVRKTEEHVLEISEIK
EILASDELTDEEKLYLKLWLTTGAREYERPSTRGVKELGWGGIVGIKVSDINFKNCTLEV
REPKTGKGLEPKIWHSIVIDLFFPGLCRELEQYVKEHGRGRDDWLWGSPERGVKLYKSIV
RKLRKLTGKPLVAHDIRRTHAYWLVQQDVPLELIAGGVTGERIESPLGVGWEDLMTMVRY
YADLAGRAKRMVPTIMAKFHEVFSS
Download sequence
Identical sequences H6QE24
gi|379005790|ref|YP_005261461.1| gi|379005790|ref|YP_005261461.1|NC_016886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]