SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330808581|ref|YP_004353043.1| from Pseudomonas brassicacearum subsp. brassicacearum NFM421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330808581|ref|YP_004353043.1|
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.52e-109
Family FMN-linked oxidoreductases 0.00000000252
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000106
Further Details:      
 
Domain Number 3 Region: 465-523,561-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.87e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330808581|ref|YP_004353043.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase (NADPH) [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
Sequence
MTVSHYPHLLAPLDLGFTTLRNRTLMGSMHTGLEEKPGGFERMAAYFAERARGGVGLMVT
GGIGPNDEGGVYSGAAKLTTEEEALKHQIVTRAVHEAGGKICMQILHAGRYAYSPKQVAP
SAIQAPINPFKPKELDEEGIEKQISDFVTCSVLAQKAEYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLPVEIVRRVREAVGPNFIIIFRLSMLDLVEGGSSWDEIVQLAKA
IEQAGATIINTGIGWHEARIPTIATKVPRAAFSKVTAKLRGSVSIPLITTNRINTPEVAE
QILAEGDADMVSMARPFLADPEFVNKAAAGRGDEINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYLPVTQVKKIAVVGAGPAGLSAATVAAERGHQVTLFDSASEIGGQFNIAK
RVPGKEEFFETLRYFKRKLQTSHVELCLDTRVDVAQLVAGGYDEIILATGIAPRVPAIPG
VEHAKVLSYLDVILERKPVGRSVAVIGAGGIGFDVSEFLVHQGVATSQDREAFWKEWGID
THLEARGGVAGIKAEPHAPARQVFLLQRKTSKVGDGLGKTTGWIHRTGLKNKQVQMLNSV
EYLKIDDEGLHIRIGETGEPQVLAVDNIVICAGQDPLRELQEGLEAAGQKVHLIGGADVA
AELDAKRAINQGSRLAAQL
Download sequence
Identical sequences F2KEP3
gi|330808581|ref|YP_004353043.1| WP_013692653.1.35230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]