SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330811249|ref|YP_004355711.1| from Pseudomonas brassicacearum subsp. brassicacearum NFM421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330811249|ref|YP_004355711.1|
Domain Number 1 Region: 98-262
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 7.45e-37
Family PA2201 C-terminal domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330811249|ref|YP_004355711.1|
Sequence length 299
Comment hypothetical protein PSEBR_a4298 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
Sequence
MIRAPLGDSRYWSEWVEYGDESIVEALETAAKPAGDPDYAPQYVFIIAQKHWHQMLRRYS
AGKPIADLSRYFPGLLDAWEEAERLGATVWTQEQQFTRHSWRVNYDHYITCFWLVGLGLA
LDIPDDQWKRLLALIGNEGEDVLLDRIIASRSPERKIGSVLLYPKPYARLLTAVDAPADS
QASLLSAFVKHWYAEVRTGAKSGSDPQAVSYRHPYWYTYGDENFEGGAYFGRWCVEAVAA
VKAFGMDDSQCLGLEHYPGDLLRPNGPSTHPARQEVEPPAAVAVENKGGFWARLLGRRE
Download sequence
Identical sequences F2KC54
gi|330811249|ref|YP_004355711.1| WP_013694076.1.1542 WP_013694076.1.16574 WP_013694076.1.35230 WP_013694076.1.48623 WP_013694076.1.55806 WP_013694076.1.57064 WP_013694076.1.63017 WP_013694076.1.93455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]