SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330807798|ref|YP_004352260.1| from Pseudomonas brassicacearum subsp. brassicacearum NFM421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330807798|ref|YP_004352260.1|
Domain Number 1 Region: 23-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.01e-59
Family PP-loop ATPase 0.00000319
Further Details:      
 
Domain Number 2 Region: 332-434
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.56e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0039
Further Details:      
 
Domain Number 3 Region: 255-327
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.7e-16
Family MesJ substrate recognition domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330807798|ref|YP_004352260.1|
Sequence length 442
Comment ExsB family transcriptional regulator [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
Sequence
MNQPTIDLPTRLLKHMLPWRNAATWRIAFSGGLDSTVLLHLLVTLSQRQPLPALSAIHVH
HGLQAVAEAWPDHCRSVCAALGVPLDVVTVQVRPGASVERAAREARYAAFVAAIHSDEVL
LTAQHRDDQAETLLFRLLRGAGVKGLAAMPPQRPLGQGHLLRPLLDVSRVELEAYARQQG
LSWIEDPSNDDHRHARNYLRQRVFPVLAEQWPQASTTLARSAAHMGEAQTLLDDLARIDL
ARAATPGVFDWLGLQSLALAPLRALSPARQRNALSHWLAPMTLLPDTDHWSGWDSLRDAA
DDARPIWRLAGGELHRAAGRVWWLSDHWLCSLPGTVDWADPAVALRLPGNGRVVLDGTPP
AGPLSVRYRQGGEVMALAGRGHRDLKRLLNEKAVPAFVRGRLPLLYQGEQLLAVANLAGL
DAQADGSWQLIWTPGSQDLGLS
Download sequence
Identical sequences F2KDT7
gi|330807798|ref|YP_004352260.1| WP_013692386.1.1542 WP_013692386.1.16574 WP_013692386.1.35230 WP_013692386.1.48623 WP_013692386.1.55806 WP_013692386.1.58660 WP_013692386.1.63017 WP_013692386.1.93455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]