SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307544423|ref|YP_003896902.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307544423|ref|YP_003896902.1|
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.29e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.058
Further Details:      
 
Domain Number 2 Region: 299-386
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000183
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307544423|ref|YP_003896902.1|
Sequence length 394
Comment precorrin-3B synthase [Halomonas elongata DSM 2581]
Sequence
MVARPAEPRVRGWCPGAWRPMATGDGLLVRVRPAMGRLTRDQSLALCDAAETFGSGLIEL
TRRANLQLRGVTEAGWPALMAFLLEHDLVAPDAEAERRPSLLLAPDWRDGDAIHRAASLL
LERFQAWPTLPDKWGLAVDAGTSPVLTEASADLRLERSADGGLLVRADGRELGTPVDDVA
TAVALMRRLAWWFVDAGGLGAGRMQRFDAPLPAWAPATTAPAETAEDDTGLALGEHSLGR
VVGLPFGRAPASVLRAALADGVTGMRVSPWRRLLLEGAGDDAEPAEGLIVDERDPRLAMD
ACPGAPHCAQASVATLGLAQALAERLDGRRPGRVHISGCAKSCARGRPAEACLTGRDGHF
DLILNGRADDTPVATGLGETDVIEYLGKHDASRL
Download sequence
Identical sequences E1V8U2
gi|307544423|ref|YP_003896902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]