SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307544628|ref|YP_003897107.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307544628|ref|YP_003897107.1|
Domain Number 1 Region: 1-187,334-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-54
Family HI0933 N-terminal domain-like 0.00000641
Further Details:      
 
Domain Number 2 Region: 189-335
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 4.58e-39
Family HI0933 insert domain-like 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307544628|ref|YP_003897107.1|
Sequence length 391
Comment hypothetical protein HELO_2038 [Halomonas elongata DSM 2581]
Sequence
MTYDVVVIGAGAAGLMCALTAGYAGRRVLVVDHANKAGKKILMSGGGRCNFTNMATTPAN
FFSRNPHFCISALKRYRPEHFVELVERHGVEHVEKAPGQLFCAGSAKELLDVLLTECEWA
GVELRLKTSVHAVERLGDGMRLSTSLGRIDAGAVVVATGGLSIPTMGATGFGYDIARQFG
LEVTETRAALVPFTLTSHWKERAAALAGLSHEVVVRCNGGEYREPMLFTHRGVSGPAMLQ
ISSYWQAGDALTIDLLPDTDAFDALVAARRETPKRRLSTWLAERLPRRLAQALVEWHGGD
APLAECSNAALTAWAGHLNDWHLKPAGTEGWRTAEVTLGGIDTRDLSSKTFEVQGLPQLR
FIGEVLDVTGELGGYNFQWAWASGVACGQAV
Download sequence
Identical sequences E1V9T8
gi|307544628|ref|YP_003897107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]