SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545177|ref|YP_003897656.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545177|ref|YP_003897656.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.39e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00023
Further Details:      
 
Domain Number 2 Region: 335-449
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.56e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307545177|ref|YP_003897656.1|
Sequence length 453
Comment glutathione reductase [Halomonas elongata DSM 2581]
Sequence
MSDFDYDLFVIGAGSGGVRAARTAAATGARVAVAEDRYLGGTCVNVGCVPKKLYSYAAHF
HEAFEDSGGFGWQLAEEPSFDWATLRDNKIGEIKRLNGIYGRLLDNADVRLINGRASVVD
AHHVEVGGETVSAEKILVAVGGWPWVPDFPGNELTLNSNQIFDLDDFPQRFLVLGGGYIA
VEFASIFNGLGSESHLVYRGELFLRGFDNEVREFTRDEMAKKGVNLHFNTNIEAIEKVET
GLKVTLTDGRTLEVDAVLAATGRRPHLAGLGLDRLDVATNDDGSLKVNERFETSMPSILA
LGDVTGGPELTPVALEEAMKLVEHHFGDTVPEPLDYERVATAVFCHPNIGTVGLSEEAAR
ERFEAIRVYSADFRPMKHTLSGSSERSLMKLIVDDASDVVVGAHMVGEEAGEIIQGIAIA
VRAGLTKAQFDQTVGIHPTGAEEFVTMRTPTRR
Download sequence
Identical sequences E1VCW6
gi|307545177|ref|YP_003897656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]