SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545197|ref|YP_003897676.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545197|ref|YP_003897676.1|
Domain Number 1 Region: 120-283
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.19e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00072
Further Details:      
 
Domain Number 2 Region: 408-549
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.06e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.6e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.018
Further Details:      
 
Domain Number 4 Region: 252-276,316-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.57e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307545197|ref|YP_003897676.1|
Sequence length 550
Comment sulfite reductase [NADPH] hemoprotein subunit beta [Halomonas elongata DSM 2581]
Sequence
MYRYDNHDQTLVDERVAQFRDQMRRYLEGKISDEEFLPLRVQNGLYIQRYAPMLRIAIPY
GMLASYQLRKLGEIAARYDRGYGHFTTRTNLQLNWPKLEDVPDILADLASVQMHAIQTSG
NDIRNTTTDQFSGIAADEDVDPRPWCELVRQWSTFHPEFAYLPRKFKIAVTGAEEDRAAI
QVHDVGLRLWRDDDGEVRVKVLAGGGLGRTPMIGGVMCEDLPWRHLLTYLEALVRVYNQF
GRRDNKFKARIKILVKALGIDEFRRRVEEEWAHLKDGPQTLTEEAVSSVAEHFVDPPRRE
VAEDAIEAYERLREENRAFARFVTNNVTDHKVSGYKAVTLSLKRHDHSPGDVTSEDMAAV
ADLADEFGYGELRVTHEQNLVLTDVPVDRMEELWQRLDALGMANPTVGTLTDLICCPGGD
YCSLANAKSIPVAQSIQERFEDLDFLYDLGPLELNISGCMNACGHHHVGHIGILGVDKKG
EEYYQISLGGSQGNESSLGKILGPSFYREDVTDVIDKLLKVYIGERNPDETFLDTYRRIG
LKPFKEQVYA
Download sequence
Identical sequences E1V312
gi|307545197|ref|YP_003897676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]