SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545414|ref|YP_003897893.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545414|ref|YP_003897893.1|
Domain Number 1 Region: 5-273
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000365
Family FAD/NAD-linked reductases, N-terminal and central domains 0.041
Further Details:      
 
Domain Number 2 Region: 191-233,276-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000544
Family FAD/NAD-linked reductases, N-terminal and central domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307545414|ref|YP_003897893.1|
Sequence length 456
Comment L-lysine 6-monooxygenase [Halomonas elongata DSM 2581]
Sequence
MDIEPLDLAGVGIGPFNLGLAALLAPHSSIRSLFLERKGDFRWHEGMMLPGTTLQVPFMA
DLVTMADPSNPLSFLNYLHVHDRLYQFYYHESFHIPREEYDHYCRWVSRQLSSCRFGEEV
SSVSHDASSDTFVIESRLTTGEFRRYRSRHLAIGVGTVPWLPQWARAHTSAPLIHSAMFA
DWQEQLSKCRQVTVVGSGQSAAECVLALYRALTPEMIEAGAAVRWITRSAGFHPMEHSKL
GQECFTPAYMSYFHDIPREKRREIVEGQGLLYKGISFSTIAEVFDLMYERSVGGRDPGLS
LAANCEVTSVEETASDRLRITLRHGPLNQTVSVESDAIVAATGYRHAWPQWFDELKSTIL
ETDAHGDAIVEADFTARRRDGSTGRVFIQNAEIFQHGVGSPDLGLGAYRNATIINQLLGR
NYYRMPARSAFQEFGLPVCSADADDEKRSSEGVAML
Download sequence
Identical sequences A0A1B8P1I2 E1V3M9
WP_013332580.1.66923 gi|307545414|ref|YP_003897893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]