SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545454|ref|YP_003897933.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545454|ref|YP_003897933.1|
Domain Number 1 Region: 5-254,346-398
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.82e-59
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 228-342
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5.38e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000126
Further Details:      
 
Domain Number 3 Region: 421-511
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.01e-17
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307545454|ref|YP_003897933.1|
Sequence length 526
Comment L-aspartate oxidase [Halomonas elongata DSM 2581]
Sequence
MTESHHDVLIIGGGAAGLALALEIADHRPVTLLQPSPDARGASRWAQGGIAAVLAPSDDV
EAHVADTLVAGDGLCDEAAVRFTVDQGPAAIEWLLSLGVPFTPDPDPNAGYPYHLTQEGG
HGARRIIHADDATGRAVIETLESHVGAHPDIRLRHDLSAIELIADTAGHCRGARCLDEAG
NLHALMARDTVLATGGASGLYRHTTSPHPASGEGMMMAAELGAELMNLEFQQFHPTCLYD
PEGAPFLISEAVRGEGGYLLGGDGQRFMPDIDPRAELAPRDIVARAIDGEMQRSGMDHVW
LDIRHLGEEAIRHHFPTIHAHCASRGLDIARSPIPVVPAAHYSCGGVSTDLTGATTVPRL
YAIGEVACTGLHGANRMASNSLLECLAFARGCARRLAEETAESGALLVERTPGTRPVSRE
LIAELREAMRGVMSAKVAIVRHDAGLDEAAGTLAGLSERLAPHLAEAAPDADAASLWHAL
RLARLTVACARARRESRGLHHNPDCPLHADATPTPSRIHLNALQTP
Download sequence
Identical sequences E1V3R9
gi|307545454|ref|YP_003897933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]