SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545704|ref|YP_003898183.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545704|ref|YP_003898183.1|
Domain Number 1 Region: 6-262,361-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.34e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000393
Further Details:      
 
Domain Number 2 Region: 453-590
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.83e-49
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000716
Further Details:      
 
Domain Number 3 Region: 239-358
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.04e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307545704|ref|YP_003898183.1|
Sequence length 590
Comment succinate dehydrogenase, flavoprotein subunit [Halomonas elongata DSM 2581]
Sequence
MSNMRSLTFDAIIIGGGGSGMRAALELAKSGKKTAVLSKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGGDYITDQEAAEYMCSEGPKAVFELEHMGLPFSRFENGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQNNLKNQTTFLNEWYAVDLVKNANGDV
VGCIAMDIETGEVVHVKAKATVLATGGSGRIYSSTTNALINTGDGIGMALRAGIPMQDME
MWQFHPTGIYGAGVLVTEGCRGEGGYLVNKDGERFMERYAPNAKDLAGRDVVARSMVMEI
LEGRGCGENGDHVYLKLDHLGEEVLGKRLPGIVELSKTFAHVDPAKEPIPVVPTCHYMMG
GVATNVHGQAIAQDADGNDQIVNGLYAVGEAACVSVHGANRLGGNSLLDLVVFGRAAGMF
IESALNEGIDYLAASDDDIEAAMRRINRWDESEGGESVPELKRALQEIMQSDFGVFRQED
NMQKGVQQLAELRERIANAYLPDKSKAFNTARVEALELDNLMEVAEATAIAALERKESRG
AHSRYDYPDRDDANWLKHSMYFPAEKRLGQREVNFAPKTVDMFEPKVRTY
Download sequence
Identical sequences A0A1B8P086 E1V4R0
WP_013332870.1.66923 gi|307545704|ref|YP_003898183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]