SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307546124|ref|YP_003898603.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307546124|ref|YP_003898603.1|
Domain Number 1 Region: 29-389
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.07e-114
Family FMN-linked oxidoreductases 0.00000000223
Further Details:      
 
Domain Number 2 Region: 360-548
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.41e-38
Family N-terminal domain of adrenodoxin reductase-like 0.00000842
Further Details:      
 
Domain Number 3 Region: 487-555,591-675
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307546124|ref|YP_003898603.1|
Sequence length 697
Comment 2,4-dienoyl-CoA reductase [Halomonas elongata DSM 2581]
Sequence
MPGLCGTRATIIQLFEFPLPDHEDSTVTAYPHLFRPITLGHLTLPNRVLMGSMHTNLEEA
PNGFERLAAFYVERAREGVGLIVTGGIAPNPEGAVFQGAATLERPEQVADHRRVTDAVHA
EQGRICLQILHAGRYAYTPEPVAPSPIQAPINPSMPRELSRDEVASTIDDYVRCASLARE
AGYDGVEVMGSEGYLINQFICRRTNRREDEWGGDFENRIRFAVEIVRRIRAELGDDFLII
FRLSMIDLVEEGSTFEEVVALGRAVEAAGADVVNTGIGWHEARVPTIVTSVPRAAFSEVT
CRMRDALSIPLITTNRINMPEVAERVLAEGQVDMVSMARPFLADPAWIAKARDGRSEEIN
TCIACNQACLDHTFQGKLTSCLVNPRACHETELVIEPAEEARTIAVVGGGPAGLAAAVTA
AQRGHAVTLYERQSELGGQFNYARRIPGKEEFDETLRYFRVMLDRHQVSVRLGTAPSVHE
LSAFDEVILATGVRPRRLEELPGIDHPKVMSYPAAIVHAERVGPRVAIIGAGGIGFDVAE
LLTHAGHPALDVEAWCEEWGVDLTVATPGGLREPRRPTVPRRVTLLQRKTSKPGKGLGTT
TGWVHRASLRHRGVETLVGCEYVGIDDEGLHIRQDGEPRLIEVDTVVVCAGQESVRDDLE
ALREAGVSVHVIGGADKAAELDAKRAIDQGTRVAAAL
Download sequence
Identical sequences E1V7I0
gi|307546124|ref|YP_003898603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]