SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307546304|ref|YP_003898783.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307546304|ref|YP_003898783.1|
Domain Number 1 Region: 272-484,580-665
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-36
Family FAD-linked reductases, N-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 482-554
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000523
Family D-aminoacid oxidase-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|307546304|ref|YP_003898783.1|
Domain Number - Region: 157-218
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000979
Family Spermidine synthase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307546304|ref|YP_003898783.1|
Sequence length 674
Comment 5-methylaminomethyl-2-thiouridinemethyltransferase [Halomonas elongata DSM 2581]
Sequence
MPPAHDPLPPLAGLTRAHLDWRPDDGGEDTPHSSEFDDVYFSRHDGRAETEHVFLDANRL
PERFQDWTEDRPFVIGETGFGTGLNMLCAWACFDAHAPARARLHLVSTELYPLDRRDLAR
ALAAWPDLADRAAVLLAQWPEPVSGVHRLWLDARVTLDLHFGDTAERLRWLDGRVDAWFL
DGFAPARNPDMWQPALFAAMAARSRPGATFATFTCAGVVKRGLAAAGFAWRKVPGFGRKR
EMLAGEIATPPADERRRATPWFTPPAPCPRRRVAVIGGGIAGTSVAAALARRGVAVTLID
REGPGAGASGNRQGVLYVKLAAETNDQSRCYLAGLLHSRRWLDALDPDGSLWQPCGVLQL
ATTPREAKRQTAFLANHPLPDSVVRGVSSEQASQLADIPIENGGLEYPLAGWVRPDALCR
RLAATPGVTLLRAEVDDITATPEGWRLSMTTDQGPDEFDADQVVIATASLANRFTQTADL
PLQPVRGQVSSLTLPENAPAPSRVICAGGYVAPPREGRLTFGATFRPNETDTRVSDADHR
ANRDELTRTLPGYAAALEGSGAPLDTAAFDGRAAVRAASPDKTPYAGPVPDAAAWRQAYA
LLAKDATRIPDLAGQHHPGLWISAAHGSRGLASAPLCAEVIASRICDEPMPLEAPLVDHL
HPGRRLIRELIRGG
Download sequence
Identical sequences E1V8E2
gi|307546304|ref|YP_003898783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]