SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307546972|ref|YP_003899451.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307546972|ref|YP_003899451.1|
Domain Number - Region: 89-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00842
Family FAD/NAD-linked reductases, N-terminal and central domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307546972|ref|YP_003899451.1|
Sequence length 235
Comment flagellar basal body P-ring biosynthesis protein FlgA [Halomonas elongata DSM 2581]
Sequence
MTRTLPATILVSMALALALVAASLFAPQARAADQAMLESVRQFLEDQASSLGDEIEVTLH
PPAAKFPACPSPRPFLPNDSQPLIGRVSVGVQCGEQGRRTRFLQAEVSVIGAYLETARDV
AAGETITRDHLVIRHGNLARLPRQTLREAGQAIGRVAMRPLSEGQVLRGYQLRKPRLVQR
GEAVTLEARGSGFRVTRPAEALAPGGRGDRIRVRLDNREILHARVVGERRLVVDN
Download sequence
Identical sequences E1VC96
WP_013334136.1.66923 gi|307546972|ref|YP_003899451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]