SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307547045|ref|YP_003899524.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307547045|ref|YP_003899524.1|
Domain Number 1 Region: 7-66,97-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.99e-47
Family GidA-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307547045|ref|YP_003899524.1|
Sequence length 631
Comment tRNA uridine 5-carboxymethylaminomethyl modification protein GidA [Halomonas elongata DSM 2581]
Sequence
MEYPDRFDVIVIGGGHAGTEAALASARTGCRTLLLTHNIETLGQMSCNPAIGGIGKSHLV
KEIDALGGAMGLATDMGGIQFRVLNARKGPAVRATRAQADRVRYKAAIRGMLENQANLTI
FQQAAGDLIVEGDQVRGVCTETGIRFMSETVVLCTGTFLGGVIHIGLDNSRGGRAGDPPS
NALAERLRALPFRVDRLKTGTPPRLDAKSVDFSKLDEQPGDEPTPVMSYLGERSQHPRQV
SCHIAHTNERTHEIIHANLERSPMFSGVIEGVGPRYCPSIEDKVHRFADKSSHQIFVEPE
GLDTHELYPNGISTSLPFDVQLQVVRSIQGLENAHITRPGYAIEYDFFDPRDLKHSLETK
FIHNLYFAGQINGTTGYEEAGAQGLLAGLNAARRARGLDAWWPRRDEAYLGVLVDDLITL
GTREPYRMFTSRAEYRLLLREDNADMRLTETGRELGLVDERRWTAFSAKREAVERETSRL
RSSWVQPGSEAARRISETTGQSLKREYNLLDLLKRPEIGYRDVAGLVGEPVDNDQVAEQV
QIQAKYQGYIDRQQDEIDKLKRHEATPLPDDLDYDQVDGLSNEIRQKLVEARPETLAQAS
RISGVTPAAVSILLIHLKKRRLLDDSRVANG
Download sequence
Identical sequences E1VCG9
gi|307547045|ref|YP_003899524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]