SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307545825|ref|YP_003898304.1| from Halomonas elongata DSM 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307545825|ref|YP_003898304.1|
Domain Number 1 Region: 635-810
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.89e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 8-196
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 3 Region: 505-643
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.25e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 151-312
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.41e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.005
Further Details:      
 
Weak hits

Sequence:  gi|307545825|ref|YP_003898304.1|
Domain Number - Region: 360-383
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0842
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307545825|ref|YP_003898304.1|
Sequence length 834
Comment assimilatory nitrite reductase, NAD(P)H, large subunit [Halomonas elongata DSM 2581]
Sequence
MKASNSAPQDLIIVGNGMVGHHLVEQLVERDAHRHYRIRVFGEERHLAYDRVHLSEYFSG
RDADDLALSTADYYAEHGIELHLHEAVTDIDRDARELVTPQGRYAYDRLVLATGSYPFVP
PIPGGDRDGCLVYRTLDDLDAIREAARSATTGVVVGGGLLGLEAANALRGLDLDTAVVEF
APRLMPMQVDNEGGELLREKIEALGVQVLTDRATQHIEDGDTSRHRMVFQDDKLLETDLI
VFSAGIRPRDELARNAGLEMGERGGVVIDDRCLTSDPAILAVGEVALWRGSIFGLVAPGY
QMAKAAADTLSGGELTFEGADMSTKLKLLGVDVGAIGDAHGDRSPGARQFRYCDQIKQEY
RKLVVSSDGKKLLGAMLVGDNATYDTLMQYYANGLELPEDPASLILPNVEGAPTLGPDAL
PDTASICSCHNVTKGAICEAIDAGCNDLGAVKGATKASTGCGGCAALLKSVVDSELEARG
VEVDQSICEHFAHTRQELYSIVRIEGIKTFGELIEKHGHGLGCDICKPAVASILASCFNE
PITDAAHVPLQDTNDTFMANMQKNGTYSVVPRVPGGEITPDKLIVLGQVGEKYGLYTKVT
GGQRIDLFGARLEDLPSIWGELLEAGFETGHAYAKSLRTVKSCVGSTWCRYGVQDSVGMA
IRLENRYKGLRSPHKLKLAVSGCTRECAEAQSKDVGVIATEHGWNLYVCGNGGMRPRHAE
LFATDLDDDTLIRYIDRFLMFYVRTADRLQRTSVWRENLEGGLDYLKEIVIDDSLGLGDE
LERQMQTVIDNYECEWAGALSDPEKLKRFRSFVNDERPDPDIIVTEERGQLRPA
Download sequence
Identical sequences E1V5G4
gi|307545825|ref|YP_003898304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]