SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156935628|ref|YP_001439545.1| from Cronobacter sakazakii ATCC BAA-894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156935628|ref|YP_001439545.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.92e-111
Family FMN-linked oxidoreductases 0.0000000000848
Further Details:      
 
Domain Number 2 Region: 333-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000238
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-25
Family C-terminal domain of adrenodoxin reductase-like 0.000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156935628|ref|YP_001439545.1|
Sequence length 672
Comment hypothetical protein ESA_03493 [Cronobacter sakazakii ATCC BAA-894]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEHPDGARRLAAFYAERARHGVALIVTGGV
APSPSGVAIQGGAVLNDAHHLPHHRVITDAVHREGGKIALQILHTGRYSYQPHPVAPSPL
QAPINRFAPHELTHDEILALIEDFARCASLAREAGYDGVEIMGSEGYLINQFLAARTNHR
EDEWGGDYARRMRFAVDVVRAVRERVGQDFIIIYRLSMLDLVEGGSTFDETVQLARAVEA
AGATLLNTGIGWHEARIPTIATPVPRGAFTWVTRKLRGLTRLPLVTTNRINDPHVAEAIL
AAGDADMVSMARPFLADAELLSKAASGREAEINTCIGCNQACLDQIFAGKITSCLVNPRA
CHETEMVSVPARTPKKLAVVGAGPAGLSFAVNAAQRGHVVTLFDASAEIGGQFTIAKQIP
GKEEFYETLRYFRRMLAVTGVTLALNTRVDAAMLAAFDEVALATGIVPRVPDIDGIEHPS
VLTYLDVLRDKAPVGQRVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLNA
PGGLRPEGPVLPKSPRQIVMLQRRAGKPGDGLGKTTGWIHRATLLARGVKMIPAVSYQRI
DDRGLHVLINGEAQVLEVDNVIICAGQEPQQALAAPLRAMGKPVHLIGGCDVALELDARR
AIAQGTLLALAI
Download sequence
Identical sequences A7MIS6
WP_012125916.1.34712 WP_012125916.1.38143 WP_012125916.1.49393 WP_012125916.1.52367 WP_012125916.1.56053 WP_012125916.1.61601 WP_012125916.1.67391 WP_012125916.1.83282 WP_012125916.1.9447 gi|156935628|ref|YP_001439545.1| 290339.ESA_03493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]