SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148260047|ref|YP_001234174.1| from Acidiphilium cryptum JF-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148260047|ref|YP_001234174.1|
Domain Number 1 Region: 635-1081
Classification Level Classification E-value
Superfamily ALDH-like 3.27e-120
Family ALDH-like 0.000000254
Further Details:      
 
Domain Number 2 Region: 246-594
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.26e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000195
Further Details:      
 
Domain Number 3 Region: 76-245
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.18e-61
Family N-terminal domain of bifunctional PutA protein 0.000000965
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000117
Family PutA pre-N-terminal region-like 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|148260047|ref|YP_001234174.1|
Domain Number - Region: 1111-1222
Classification Level Classification E-value
Superfamily ALDH-like 0.0257
Family ALDH-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148260047|ref|YP_001234174.1|
Sequence length 1270
Comment delta-1-pyrroline-5-carboxylate dehydrogenase [Acidiphilium cryptum JF-5]
Sequence
MAVSTMGVKLDDQVRARLRALAEREGRTTHHLAKQLILAGLERLERGEALDAAVTAEDDA
PAAVPFLEFVQDVQPQTVLRAAITAAYRIPETDAVAGLIEGATLPAAAAKQARATATNLV
TALRARRNAGLVETLLQEYALSSHEGIALMCLAEALLRIPDAATRDALIRDKIGAGDWQS
HLGGNKSVFINAATWGLLLTGRLNATASEAGLSSALTRLLARGGEPVVRRGVNIAMRLMG
EQFVMGRTIGEALANARKREAKGFAYSYDMLGEAALTAADAARYYRDYEQAIHAIGAAAG
GKGIYRGPGISVKLSALHPRYCRAQRARVMEELAPRLKALALLARRYDIGINIDAEEADR
LDLSLDLLEGLCFEPGLAGWNGIGFVVQAYQKRARSVIEFLIDLARRSRHRLMVRLVKGA
YWDSEIKRAQLDGLEGFPVFTRKIHTDLSYLACARAMLAARTEIFPQFATHNALTLASIH
ALAGPAFEVGDYEFQCLHGMGEPLYEEVVGPQKLDRPCRIYAPVGTHETLLAYLVRRLLE
NGANTSFVNRLADRRVPVEALIEDPVAAARKIEPLGAPHPKIALPGAILGTRRNSAGFDL
TSEQRLASLGSALLASLEQDWRAAPPDADPAAPGRTVVNPANIADRVGTVIEPDAGAVGA
ALARAAAMAPIWQATPAAERAAILLRAADLLEHRMTALVGLIVREAGKSLPAAIGEVREA
VDFMRYYAGQLQDGFDNETHRPLGVVAAISPWNFPLAIFTGQVVAALAAGNVVLAKPAEE
TPLIAAQGVRIMHEAGVPADALQLLPGDGRTGAALVGDARVGGVVFTGSTAVARLIQATL
ARRLDADGMPVPLIAETGGQNAMLVDSSALLEQAVGDIVTSAFDSAGQRCSALRILLVQD
DIADPLLAMLRGAMEELAVGATDRLSSDVGPVITREARDNIRAHVETMEGRGHKVFSVAL
PPETEGGWFVAPTMIEIDHPSALEREVFGPVLHVVRYRREERNAMVAAVNALGYALTFGV
HSRIDETIAQAVGKAEAGNIYVNRNIVGAVVGVQPFGGHGLSGTGPKAGGPFYLRRLLAR
RPMPHGEGEPAPAFTKLVGWMREQGIETAPALRYAAASAFRDAELPGPVGEQNTLRLKPK
GLVLCRAASPEGMWRQVAACLATGNAPLVLCDGAEAEIARMPAEIRPAIAPADAVARAEF
SAVLFEGHRDALIALQMALAERDGPIVPVHALPAEDHSEWDYPLEFLLEEQSISVNTAAA
GGNASLMSIG
Download sequence
Identical sequences A5FXC3
349163.Acry_1039 gi|148260047|ref|YP_001234174.1| WP_011941945.1.19560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]