SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148260924|ref|YP_001235051.1| from Acidiphilium cryptum JF-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148260924|ref|YP_001235051.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.49e-34
Family Ribosomal protein L6 0.0000662
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.14e-22
Family Ribosomal protein L6 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148260924|ref|YP_001235051.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Acidiphilium cryptum JF-5]
Sequence
MSRVGKYPVALPQGVSITVVDGILTAKGKLGELKMPLSERVETVVEDGKVTVSPRDKEAA
SRMMWGTTRANVANMVQGVSQGYAKTLEINGTGFRAAVQGSNLVMNLGFSHDVVYPVPQG
IKITCEKPTSIKVEGIDKRLVGQVCAELRAFRPPEPYKGKGVKFEGEAIRRKEGKKK
Download sequence
Identical sequences A5FZV0
349163.Acry_1931 gi|148260924|ref|YP_001235051.1| WP_012039717.1.19560 WP_012039717.1.41512 WP_012039717.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]