SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310777817|ref|YP_003966150.1| from Ilyobacter polytropus DSM 2926

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310777817|ref|YP_003966150.1|
Domain Number 1 Region: 202-398
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-77
Family B3/B4 domain of PheRS, PheT 0.0000082
Further Details:      
 
Domain Number 2 Region: 35-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-51
Family Myf domain 0.0031
Further Details:      
 
Domain Number 3 Region: 469-685
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.43e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 4 Region: 697-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.06e-23
Family Anticodon-binding domain of PheRS 0.00078
Further Details:      
 
Domain Number 5 Region: 406-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.69e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310777817|ref|YP_003966150.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Ilyobacter polytropus DSM 2926]
Sequence
MLISLDWLKQYVDIKENTKELENTLTMIGQEVEAIEVQGEDLDNVVVGQIVEYGRHPEAE
KLSLLKVEVGEGEPLQIVCGAPNHKDGDKVVVAKLGAVLPGEFKIKKAKVRGIESCGMLC
SEVELGIGEDGEGIIILPEDAPVGEEYRKYIGLDDTIFELEITPNRPDCLSHIGIAREVA
AYYKRKVKYPKYEMDEVIEPASSHIHVNIEDKERCKRYCTRILKGVKIQESPEWLKKRLR
SIGLRPINNIVDITNFVMFEYNHPMHAFDLDKLDGSKIIVRKAKTGEKIVTLDEEERELN
NGELVIADEKKPVAIAGIMGGLDTKVDEETTDILLEVAYFTPENIRKTSKSLGLSSDSSY
RFERGIDRENSIEVIDRAAKLMKDIAGGEILSGIVEKYVEKYEKIELTLDIDKLNKFVGK
EISVETVGEILRNLGLEIKALVGKILTVCPPSYRSDLVRTADLYEEVIRMYGFENIEDVM
PEANIKAGVKDPETEAVDKVKLVLKKLGLQEVINYSFIPSDAVSKLKMNVETMAIKNPIN
EDLAVMRPTLIYGLLSNIRDNFNRNQFDLKLFEVSRTFTSSEELANEEVKIAVAVSGRAE
KDLWNSKPEAYDFFDIKGYVEGFLEYMGINRFQLARTNNPTFHPGRSAEIRMGKDVIGSF
GEIHPDVAEAMDIKKERAYIAELDLIKILKYGKSKIKYERIVKFPAVTRDLAIVLDGDIL
VGDMLGDIKKSSKIIESVELFDVYQGDKVESGKKSVAINIVMRKSNGTLEEKEITEGVEK
ILQTIRKKYKGEIRQ
Download sequence
Identical sequences E3H643
gi|310777817|ref|YP_003966150.1| WP_013386474.1.36262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]