SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310780199|ref|YP_003968531.1| from Ilyobacter polytropus DSM 2926

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310780199|ref|YP_003968531.1|
Domain Number 1 Region: 1-281
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-93
Family Methylenetetrahydrofolate reductase 0.00000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310780199|ref|YP_003968531.1|
Sequence length 288
Comment 5,10-methylenetetrahydrofolate reductase [Ilyobacter polytropus DSM 2926]
Sequence
MFIKDIYESKKPVISFEIFPPNERYPVEKVYDTIDELVKLSPDFISVTYGAGGTTRGRTV
EIASRIKKVNNVEVLAHLTCIGADKVEIDGILDELKENGINNVLALRGDYPNDGSIPEGD
FKYAHQLVKQIKERGGFSIGGAFYPEGHQESNDLMDLFHLKRKAEEGTDFLISQIFFDNS
YFYDFKEKAKKLEIDVPLVAGIMPVTDARQIKRITALCGSSIPPKFQRILDRYENNPEAL
KDAGIAYAVEQIVDLISSGVDGIHLYTMNKVDTTQKIMDAIANLRIAL
Download sequence
Identical sequences E3HDJ7
WP_013388842.1.36262 gi|310780199|ref|YP_003968531.1|NC_014633 gi|310780199|ref|YP_003968531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]