SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310780202|ref|YP_003968534.1| from Ilyobacter polytropus DSM 2926

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310780202|ref|YP_003968534.1|
Domain Number 1 Region: 2-387
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.22e-106
Family Homocysteine S-methyltransferase 0.00000432
Further Details:      
 
Domain Number 2 Region: 344-588
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.09e-68
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00036
Further Details:      
 
Domain Number 3 Region: 875-1138
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.32e-46
Family Methionine synthase SAM-binding domain 0.00012
Further Details:      
 
Domain Number 4 Region: 719-857
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 6.28e-41
Family Cobalamin (vitamin B12)-binding domain 0.0000112
Further Details:      
 
Domain Number 5 Region: 631-713
Classification Level Classification E-value
Superfamily Methionine synthase domain 6.15e-22
Family Methionine synthase domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310780202|ref|YP_003968534.1|
Sequence length 1141
Comment methionine synthase (B12-dependent) [Ilyobacter polytropus DSM 2926]
Sequence
MRELLKEKILILDGAMGTAIQNYSLEESDFRGELFSHIKGSLRGCNELLNLTKPEVLEEI
HLSYLEAGADIIETNTFNSNRISMREYGLEEKSYDLSKAGAELAVKAARKYEYDNKKRIF
VAGSMGPTSKSASIPTGGDPFGREVSYSELKAAYKEQALGLFDGGVDAFLIETIFDGLNA
KAAVIAIEEVLEEKGEKLPIMISGTVDVNGKLLSGQSIESLIVAIDRDSIISYGLNCSFG
AKELIPLIKKLGKLTKKNISLYPNAGLPNEKGEYDETPHMTGSYVKELIENKDINILGGC
CGTTPEHIKVMAELAQGKSPRKTSMENLAGIVSGNDTVSLHEEFLVVGERNNVSGSRKFA
RLIREESYDEALDIARTQVEKGAKILDINLDDALLDSVEEMEKFIRLLQNDMILSKLPIM
IDSSNFDVIEKGLENLAGKGIVNSISLKDGEHEFLRKAAVVRKFGAALVVMAFDEKGQAV
SSERKKEICKRAYELLTSNNFPAEDIIFDPNVLTVGTGTEEDRMHGVDFIDSVKWIKENL
PGAGVSGGVSNLSFAFRGNNILRHTIHKIFLEEGEKAGMTMAIVNPGEDPGNITPEVRKA
VENLLAGDKNAVDEILNLSFEKSAKKTAEIKPVTVEERLKDYLLKGRSQGIEDDIKTALE
KYSPLQVIQEVLMEGMEEVGALFEKGELFLPQILRSAAVMEKAVEFLTPLIEAGGKEKNV
KGKVLMATVEGDVHDIGKNIVGTVLKCNGFDVVDLGVMVPKDQILEAILRHDVDMVTLSG
LITPSLMEMEKVAEMMAEQNMDIPLLIGGAAASELSTAVRIEPKYSGRVIHVTDASGTLP
VVSSLMSEKKSDFLDERKKKAEYLRDAYLKNKNKKEMHSLEEARKRRKKLDNAIEYPKEI
GKQFIEIALEDLEPLIDWDMLLHALKSKGNTQEKKVLDESKEILSKMKDMNIKAKCAFGI
FNLFKDEDTLIVSGEKDYELPMVRSQIGNETISMADFFSKEDHIGAFVISVPEIAGSDDY
ESIIYQLLGTRLAEAASEWMEKYVNDNIWRVNIRPAIGYPSVPDHSMKKEIFKLVDGAET
GAKLSSNYAMTPLSSVCGLYVSNPNSFYFDPGKISYDQLKELANLRGLSVDDMNALLGGI
V
Download sequence
Identical sequences E3HDK0
gi|310780202|ref|YP_003968534.1|NC_014633 gi|310780202|ref|YP_003968534.1| WP_013388845.1.36262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]