SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331268807|ref|YP_004395299.1| from Clostridium botulinum BKT015925

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331268807|ref|YP_004395299.1|
Domain Number 1 Region: 438-460,492-556
Classification Level Classification E-value
Superfamily TPR-like 0.00000000787
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331268807|ref|YP_004395299.1|
Sequence length 599
Comment hypothetical protein CbC4_0622 [Clostridium botulinum BKT015925]
Sequence
MTNTKDKSCLYLAIVIFIINVIPYCILGEGLSSAILLLIGTSYIIINKYKIFADVYVLIL
ICITILGVISLSQSNNIFLSLEGIFTYLCGIIFYILFFHLKDKKEEIYDYFVYFFSMGVF
ISILYQGIYMNKRIYGNIGYVNTYSILMVLVLYINTIRENNNFRNLIEYVLISGVLYTCS
RYTLVFLCIFIFLEVMVKFRMHNHNKVIINFVLSIITYTLCSQVGGMAIIFMPPIIYLIY
YISDNTKLKNKRIFSLCLIIVALFSVCFSKAQLFLRLKNISIHIPVVQERLIYYEDSIKA
ILSNIFGFGINSYQYKQYGIQSAFYDVKYIHNSLIQHSFDLGVLGGVLFIVLFVYGLVYI
NKTIKDDKKIYYAIMYLSIYAHSMLEFDFSFSIITIIISMILALNKEEHDNKELKDKLSY
SINFLVVMFSVYFICCSACNILGNIYESSGQLKLAEKFYKWNETITFEKNSETYIFLAQV
SKGDDKIKNLIKAEKLNPYDPRIKLNMAFLYEKNNDFYNANKYYEKALGIEKFYADIYTK
YFSFLQKAYKATNDKMFLNNQQTLKRLYYKNLEKLNSKSKYMKNQLPQNFNEVVKKVTN
Download sequence
Identical sequences A0A0L7ERC5
gi|331268807|ref|YP_004395299.1| WP_013724836.1.11614 WP_013724836.1.1870 WP_013724836.1.24327 WP_013724836.1.26110 WP_013724836.1.2992 WP_013724836.1.40424 WP_013724836.1.47080 WP_013724836.1.51864 WP_013724836.1.55416 WP_013724836.1.67530 WP_013724836.1.72333 WP_013724836.1.82738 WP_013724836.1.85307 WP_013724836.1.87213 WP_013724836.1.92526 WP_013724836.1.96185 WP_013724836.1.96458 WP_013724836.1.97976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]