SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331269174|ref|YP_004395666.1| from Clostridium botulinum BKT015925

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331269174|ref|YP_004395666.1|
Domain Number 1 Region: 228-347
Classification Level Classification E-value
Superfamily TPR-like 5.31e-19
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331269174|ref|YP_004395666.1|
Sequence length 361
Comment TPR repeats containing protein [Clostridium botulinum BKT015925]
Sequence
MNMDVKARFKDKLSNLLFLQMNKERVEKVFNTKLETNEEVYMPVATEDIVHKVKNNEDVD
NIPVAFFIEGMSYVLGADEKFKYNDIYEKIILSVPKSSEFIKGRIANYVKEKKYEEAYII
LKGLSKVEKTEEIYNKLIMLADKLRILNKEYVEEELEVIDKAKLIEGYAMPYLYEALIKK
DKEDFYGALFGINNYIAKGGVETPEISELKNSLKIVNDYDEGKKLVYDEPQKALDLLVPL
LSELGDNAEIYYHIAVAYRILENSPKAIHYLEKSMEIDSSYPEVFNELGINYACLQDFES
AIVYLRKVFEVTRSIEVCTNLIMCYINIGDYKQAKAHLEIAEKINNEDEIVKQLNNILKD
A
Download sequence
Identical sequences WP_013725201.1.11614 WP_013725201.1.1870 WP_013725201.1.24327 WP_013725201.1.26110 WP_013725201.1.2992 WP_013725201.1.40424 WP_013725201.1.47080 WP_013725201.1.51864 WP_013725201.1.55416 WP_013725201.1.67530 WP_013725201.1.72333 WP_013725201.1.82738 WP_013725201.1.85307 WP_013725201.1.87213 WP_013725201.1.91623 WP_013725201.1.92526 WP_013725201.1.96185 WP_013725201.1.96458 WP_013725201.1.97976 gi|331269174|ref|YP_004395666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]