SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331270284|ref|YP_004396776.1| from Clostridium botulinum BKT015925

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331270284|ref|YP_004396776.1|
Domain Number 1 Region: 217-301
Classification Level Classification E-value
Superfamily TPR-like 0.0000000128
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Weak hits

Sequence:  gi|331270284|ref|YP_004396776.1|
Domain Number - Region: 38-114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00133
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 110-176
Classification Level Classification E-value
Superfamily YehR-like 0.0115
Family YehR-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331270284|ref|YP_004396776.1|
Sequence length 317
Comment hypothetical protein CbC4_2114 [Clostridium botulinum BKT015925]
Sequence
MVLKKSLDGDFREDSQKIDTTELGVLTKAVNLTLDNYRKSIDKISTKVSSTEYENDFYNY
NMNIKKIDNIEIDIKEINGQIKRVYDKNKELEESIKLLTQEILESQVQLDKLREEENNLR
SKTSSNKLNNEENEDVREDIFNVVESTKGLEEKIINFKVKVDVSTMDIRANEELICNHKH
EIENKKNEKLCLMILSSSLDECLKFEEHIEEKTPFTKYCFQGLLNYNKGEYKEALNNFDN
YFKREEEPYENYYIREIYAKLLIENNRYEEAKQYAMEALKDKPEEIEIHKILSKVHKVLG
EEEEQILEDSIVYMLEG
Download sequence
Identical sequences gi|331270284|ref|YP_004396776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]