SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397650950|ref|YP_006491531.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397650950|ref|YP_006491531.1|
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.87e-78
Family GHMP Kinase, N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 183-350
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.77e-56
Family Galactokinase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397650950|ref|YP_006491531.1|
Sequence length 352
Comment galactokinase [Pyrococcus furiosus COM1]
Sequence
MSKITVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITAEKYDKVQLYSEHFNEEKTFTL
DNLTKEGSWIDYVKGVLWVLIQEGYKIGGLKGKITGDLPLGAGLSSSASFEVGILEVLNQ
LYNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFPK
DVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFSY
IVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMELGAYGA
RLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVGV
Download sequence
Identical sequences I6TV93 Q9HHB6
gi|18976817|ref|NP_578174.1| WP_011011563.1.13913 WP_011011563.1.59273 Pfu-461891-001 1s4eA gi|397650950|ref|YP_006491531.1| 1s4e_A 1s4e_B 1s4e_C 1s4e_D 1s4e_E 1s4e_F 1s4e_G 1s4e_H 1s4e_I 186497.PF0445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]