SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652086|ref|YP_006492667.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652086|ref|YP_006492667.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 6.54e-50
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000084
Further Details:      
 
Domain Number 2 Region: 138-270
Classification Level Classification E-value
Superfamily Translational machinery components 3.88e-44
Family ERF1/Dom34 middle domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 272-414
Classification Level Classification E-value
Superfamily L30e-like 5.18e-40
Family ERF1/Dom34 C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397652086|ref|YP_006492667.1|
Sequence length 417
Comment peptide chain release factor 1 [Pyrococcus furiosus COM1]
Sequence
MTSRDAQLYELKKKIDELKKIRGRGTELISLYIPAGYDLSKVMQQLREEYSTAQNIKSKT
TRKNVLGALERAMQHLKLYKQTPENGLALFVGNVSEMEGVTDIRLWAIIPPEPLNVRLYR
CDQTFVTEPLEEMLRVKEAYGLITVEKNEATIGILRGKRIEVLDELTSNVPGKTRAGGQS
ARRYERIREQETHEFMKRIGEHANRIFLPLLESGELKGIIVGGPGPTKEEFVEGDYLHHE
LKKKIIGIVDISYHGEYGLRELVAKAADILRDHEVIRERNLVNEFLKHIVKDTGLATYGE
REVRKALELGAVDTLLISEGYDKVRVHVKCNNCGWEELKTMSEEEYEAYKKRIQTCPKCG
SQNLTFEKWEVAEELIKIAEEAGSNVEIISLDTEEGQQFYRAFGGLGAILRFRIQGV
Download sequence
Identical sequences I6V077
WP_014835448.1.13913 WP_014835448.1.59273 gi|397652086|ref|YP_006492667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]