SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320155153|ref|YP_004187532.1| from Vibrio vulnificus MO6-24/O

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320155153|ref|YP_004187532.1|
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.65e-96
Family Methylenetetrahydrofolate reductase 0.000000000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320155153|ref|YP_004187532.1|
Sequence length 297
Comment 5,10-methylenetetrahydrofolate reductase [Vibrio vulnificus MO6-24/O]
Sequence
MGYTHASHIDALNQNIAELSDNINVSFEFFPPSTPQMEETLWNSVHRLKTLQPKFVSVTY
GANSGERDRTHSIIKEIKAQTGLVAAPHLTCIDASREELINIANDYWANGIKNIVALRGD
IPPGGGAPDMYASDLVTLLKSLHDFDISVAAFPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVSNFKQASRFAAQNNVKVPGWMAKQFE
GLDDDPVTRQLVGASQAIDMVRILSREGVKDFHFYTLNRAEMTYALCHTLGVRPKKA
Download sequence
Identical sequences A0A0H0XZ36 A0A1L9KTY3 A0A1W6M7D3
WP_011079341.1.100126 WP_011079341.1.16238 WP_011079341.1.17874 WP_011079341.1.21633 WP_011079341.1.22778 WP_011079341.1.25536 WP_011079341.1.31968 WP_011079341.1.33883 WP_011079341.1.34622 WP_011079341.1.49981 WP_011079341.1.512 WP_011079341.1.53345 WP_011079341.1.54486 WP_011079341.1.54603 WP_011079341.1.54858 WP_011079341.1.55006 WP_011079341.1.58885 WP_011079341.1.59022 WP_011079341.1.61535 WP_011079341.1.66219 WP_011079341.1.66581 WP_011079341.1.73066 WP_011079341.1.78369 WP_011079341.1.78668 WP_011079341.1.79678 WP_011079341.1.81060 WP_011079341.1.81460 WP_011079341.1.8292 WP_011079341.1.8379 WP_011079341.1.86005 WP_011079341.1.89979 WP_011079341.1.90288 WP_011079341.1.93668 WP_011079341.1.94371 WP_011079341.1.9921 WP_011079341.1.99976 gi|320155153|ref|YP_004187532.1| gi|27364761|ref|NP_760289.1| 196600.VV3006 216895.VV1_1366 gi|161486594|ref|NP_935799.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]