SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320159356|ref|YP_004191734.1| from Vibrio vulnificus MO6-24/O

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320159356|ref|YP_004191734.1|
Domain Number 1 Region: 553-1037
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-128
Family ALDH-like 0.000000485
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.89e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000032
Further Details:      
 
Domain Number 3 Region: 17-188
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.48e-64
Family N-terminal domain of bifunctional PutA protein 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320159356|ref|YP_004191734.1|
Sequence length 1043
Comment proline dehydrogenase (Proline oxidase)/delta-1-pyrroline-5-carboxylate dehydrogenase [Vibrio vulnificus MO6-24/O]
Sequence
MFTATDVLKPEFVAQPLDKLWALISPLYMVDESQWLEQLLPLATPSAEEKQAIASRTTQL
IEAIRADKKSIQLIDALLLEYSLDTHEGILLMCLAEALMRIPDAATADALIKDKMSVADW
KSHLKNSESVFVNASTWGLMLTGKVVGLGDDETQSASQALNRLVNKLSEPVIRKAMYQAM
KIMGHQFVRGRTIEEAQKNGRPMRDKGFTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
RETYGNDTSPAPSVSIKLSALHPRYEVANEHRVMSELFDTLAQLLKRAVELDVAITIDAE
EADRLELSLKLFEKLYRSETVKGWGKFGLVVQAYSKRALPVLVWLNALAKEQGDLIPLRL
VKGAYWDSEVKWSQQRGYDNYPVYTRKEATDVAYLACARFLLSDDVRGNIFPQFASHNAQ
TVSSIATMATHSDYEFQRLHGMGDSLYNHVMEQYRQPVRIYAPVGSHKDLLPYLVRRLLE
NGANSSFVHRLVDARCPVAELTKHPVEALTSFETLNNTKIPLPAAIFPERKNSYGVNVDI
ESEAKPFEAQVESFLSKQWLAGPIINGASLAESMIKDGQAESVTAPYDRRIQVGQIAFAN
LDHVSQAIDIAQAAFADWNRTPLVEKARCLDNLADLMEANLAELVALCHQEAGKTLHDSI
DEVREAVDFCRYYAKQAQNLQPFELEGFDGVKRIASREGLGVFVCISPWNFPLAIFLGQV
TAALVAGNTVVAKPAEQTSLIAVRAVELMLQAGFPASVVQLIPGRGADIGSALTSHPSIA
GVAFTGSTATAQRINVTLAQREAKPVPFIAETGGQNAMIVDSTALPEQVVRDVIRSAFAS
AGQRCSALRVLFVQQDIADRVIGLIQGAMNELSVGVPYLHKTDVGPVIDARAKEKLLQHI
EQMNQTQKPIAQLTLADDCQHGDFVTPTAFEISGIDVLKEEQFGPILHIVRFKASELTRV
VEHINQTGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGTG
PKAGGPHYLYRFTQVQFNQTENA
Download sequence
Identical sequences Q8VQN5
WP_015728452.1.25536 WP_015728452.1.73066 WP_015728452.1.8379 gi|320159356|ref|YP_004191734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]