SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320155007|ref|YP_004187386.1| from Vibrio vulnificus MO6-24/O

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320155007|ref|YP_004187386.1|
Domain Number 1 Region: 6-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.01e-83
Family Ribosomal protein L1 0.000000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320155007|ref|YP_004187386.1|
Sequence length 233
Comment 50S ribosomal protein L1p [Vibrio vulnificus MO6-24/O]
Sequence
MAKLTKRMRVIREKVDVTREYEINEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVR
GATVLPHGTGRDIRVAVFAQGANAEAAKEAGADIVGMEDLAEQVKKGEMNFDVVVASPDA
MRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDF
SAEQIKENLEALLVALKKAKPSSAKGSYLKKVSISTTMGAGVAVDQGTLNTQA
Download sequence
Identical sequences A0A0H0Y6K9 A0A1L9KTI0 A0A1W6M7W0 Q7MGR5 Q8DD23
gi|27364613|ref|NP_760141.1| gi|320155007|ref|YP_004187386.1| gi|37681346|ref|NP_935955.1| WP_011079198.1.16238 WP_011079198.1.17874 WP_011079198.1.21633 WP_011079198.1.22778 WP_011079198.1.25536 WP_011079198.1.34622 WP_011079198.1.53345 WP_011079198.1.54486 WP_011079198.1.55006 WP_011079198.1.58885 WP_011079198.1.66581 WP_011079198.1.73066 WP_011079198.1.79678 WP_011079198.1.81460 WP_011079198.1.8379 WP_011079198.1.90288 WP_011079198.1.93668 WP_011079198.1.94371 WP_011079198.1.9921 WP_011079198.1.99976 196600.VV3162 216895.VV1_1208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]