SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320155930|ref|YP_004188309.1| from Vibrio vulnificus MO6-24/O

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320155930|ref|YP_004188309.1|
Domain Number 1 Region: 446-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320155930|ref|YP_004188309.1|
Sequence length 587
Comment sulfate permease [Vibrio vulnificus MO6-24/O]
Sequence
MAKIILSQWFPGLVQLKHYQKEWLADDVRAAFSVVAVALPVAIAYAQLTGVSAIVGLYSC
VLPMLVYALMGTSRQLIVGPDAATCAVIAAVVTPLAAGDATKHWQLVMTMTAMTGMWCVL
ASRLKLGILADFLSRPILLGLLNGVALTIIVGQFAKVVGWKYEQRYLLERLWEAPQRLAD
LHWPTLALSVATVVVYLITKRFRPSWPAAMLAILITTASVWLLRLQEVGVSVVGLTQGGF
PNFQTPEFELGVTRELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGFANI
ASAFSQGFAISGADSRTAVNDANGGKSQLVSIIAAITIAVIAVFIYQPLQFIPIASLGVV
LIIASLSLLDLKGIWILRKRDKDAFYLASITFVSVLVIGVIPGITLAVLLGLFQFLRIVM
RPSDQLLGLDEEGTIRTVDGTGKATPIPGMVIYRFNSPLTYFNAPYFKRRLLEHAEHTKD
VGCVVVDAVSSFTHLDLSVMATLADVHETLKKRGIRLILAGRKRRLRQWCELTGISTSEG
GILLRADMYLAIKLSGCYLSAVGEGQVPTVQKEPDLEEPPKAIPEVA
Download sequence
Identical sequences A0A1W6M524
WP_013571457.1.100126 WP_013571457.1.21633 WP_013571457.1.22778 WP_013571457.1.54486 WP_013571457.1.54858 WP_013571457.1.59022 WP_013571457.1.66581 WP_013571457.1.73066 WP_013571457.1.78369 WP_013571457.1.81460 WP_013571457.1.8292 WP_013571457.1.8379 WP_013571457.1.89979 WP_013571457.1.93668 WP_013571457.1.9921 WP_013571457.1.99976 gi|320155930|ref|YP_004188309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]