SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320158341|ref|YP_004190719.1| from Vibrio vulnificus MO6-24/O

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320158341|ref|YP_004190719.1|
Domain Number 1 Region: 24-202
Classification Level Classification E-value
Superfamily E set domains 3.08e-56
Family E-set domains of sugar-utilizing enzymes 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320158341|ref|YP_004190719.1|
Sequence length 485
Comment chitin binding protein [Vibrio vulnificus MO6-24/O]
Sequence
MKKQPQKTLLAIALSVVSGTAMSHGYVSAVENGVAEARVTLCKFAASTGEKNTNCGAIQY
EPQSVEGPDGFPASGPRDGKIASAESALANALDEQTADRWVKRPIQAGAQNFEWTFTANH
VTKDWKYYITKPDWNPNQPLARASFDLTPFCVVDGGMVQPPKRVSHTCNVPEREGYQVIL
AVWDVGDTAASFYNVIDVKFDGDGPALPDWQQGGQIIPTMNLNVGDTVFTRVFDLAGENP
AYTTELAIDSDALTVANNWSHALAVKINQTQSEIAAGQLNEQNQFVPVYGTNPIFLKSGS
NLQRVEIGYKIETPAPEYDVTLSGLASEYQISDVPVTLDLSLQATGDITTELTVYNHHKE
PLAFETVAMKDGENKAVSMTLSKSEAGHHMLVTKVLDKDGTLQKQQTSDFMLTETQTPPP
SDDYDFVFPDGLSSYTAGTKVLASDGAIYQCKPFPYSGYCVQWTATATQYQPGTGSHWQM
AWDKL
Download sequence
Identical sequences A0A1W6M9U7
WP_015727702.1.25536 WP_015727702.1.73066 WP_015727702.1.8379 WP_015727702.1.93668 gi|320158341|ref|YP_004190719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]