SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325967653|ref|YP_004243845.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325967653|ref|YP_004243845.1|
Domain Number 1 Region: 8-261
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.23e-46
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00037
Further Details:      
 
Domain Number 2 Region: 248-411
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.8e-40
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325967653|ref|YP_004243845.1|
Sequence length 414
Comment acyl-CoA dehydrogenase [Vulcanisaeta moutnovskia 768-28]
Sequence
MYLGFCDLLMDFDLSREEALFRDSVREFGERYIKPHWVDLDEGKYSLLELIPRLAEHGLI
GLTLSSKYGGSEGSFLMAAIAAEELANADPSLAVPVYFLLETAWPFIVQRYAKDSTKEEV
LPRLTKGEAWIGIASTEPQGGSDVGNERTEAKLVNGKWLLTGEKNMVTGVSIALRLPYGG
GFVTITRTGPIEAKHRAITTMLFMVKRNGVVNTGFETRDYEEWGRRGIPTGYLRLNGAPV
DPDFVLGEVNNGFKIAMEGFDVARTLIGAAALGTARWMLEQGREWIRSRVVFGKPISSYQ
SISFKYAELSTRLEAARLMVYKAAWLADKFYRGDSSVSILDIANAGAMAKMLAVELAVDV
GLEVMKWFGGMSYYKETPVTRAFLGALSYYVGAEGAQNILRLIVARNLIGREVE
Download sequence
Identical sequences F0QSJ2
gi|325967653|ref|YP_004243845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]