SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325968474|ref|YP_004244666.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325968474|ref|YP_004244666.1|
Domain Number 1 Region: 137-217
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000108
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|325968474|ref|YP_004244666.1|
Domain Number - Region: 54-135
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0017
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325968474|ref|YP_004244666.1|
Sequence length 308
Comment mechanosensitive ion channel MscS [Vulcanisaeta moutnovskia 768-28]
Sequence
MGSNVVSVGRLVVRLLLEWILLAIIGVLIYVLYINIVFYIIPISWKSVLLTYDSVVRSII
IVTIGVVLVWDTGRRISDYISKYDSVKGTVLKFVLDTILIVAILIALAVTFERFGLSVAA
FSGTAVGIIVGLAAQQTLSNVIAGIVIIMTGRYKPGDRVTIVNWRYGIIRVMYPHEGLPN
GFTGIIRNITLMFTEVVSDAGWEYTIPNYVMLDALIIHRNLAPFKRIRARIDMPSSIDPW
IFEERIKESLKDGRIKSIKIKVGETWQSTNLYQAIIEVLADGKADGEEIKDLVLREAVRI
RNELSKQQ
Download sequence
Identical sequences F0QXC5
WP_013604326.1.51010 gi|325968474|ref|YP_004244666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]