SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325969330|ref|YP_004245522.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325969330|ref|YP_004245522.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily YjgF-like 2.04e-45
Family YjgF/L-PSP 0.0000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325969330|ref|YP_004245522.1|
Sequence length 127
Comment endoribonuclease L-PSP [Vulcanisaeta moutnovskia 768-28]
Sequence
MPRTTIFTDKAPKPIGPYSQAVRVGNTLFISGQIPIDPSTGQLVKGSVKEQTERVLENIK
AILEAAGYSLVDVAWVFVALKDLSRFSEFNEVYSRYFKENPPARITVEVSNLPGGALIEI
SAIAVKD
Download sequence
Identical sequences F0QVB8
gi|325969330|ref|YP_004245522.1| WP_013605182.1.51010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]